DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hbn

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:358 Identity:69/358 - (19%)
Similarity:94/358 - (26%) Gaps:217/358 - (60%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PSHLSQHLGQSPHSPVSSSSPFQQHHPQVQQQHLNHQQQQHLHHQQQQHHHQYSSLSAALQLQQQ 164
            |.|: .||    ||..|:.|           .||:|||||  .|.|||||.|          |||
  Fly    68 PHHI-HHL----HSSNSNGS-----------NHLSHQQQQ--QHSQQQHHSQ----------QQQ 104

  Fly   165 QHHISKLAAAAVASHGHAHQQLLLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASA 229
            |                 .|||.:                            ::..::||     
  Fly   105 Q-----------------QQQLQV----------------------------QAKREDSP----- 119

  Fly   230 SASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTD 294
                                                   .::.|||.                  
  Fly   120 ---------------------------------------TNTDGGLD------------------ 127

  Fly   295 TVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAG 359
             |.|..:..|                                  ||.|                 
  Fly   128 -VDNDDELSS----------------------------------SLNN----------------- 140

  Fly   360 GAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPR--RRGRQTYTRFQTLELEKEFHFNHY 422
            |..::|:.|                            ||  ||.|.|:|.||..:||:.|....|
  Fly   141 GHDLSDMER----------------------------PRKVRRSRTTFTTFQLHQLERAFEKTQY 177

  Fly   423 LTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455
            .....|.::|..|.|:|.::::||||||.|.:|
  Fly   178 PDVFTREDLAMRLDLSEARVQVWFQNRRAKWRK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 21/51 (41%)
Abdominal-A 456..478 CDD:289192 69/358 (19%)
hbnNP_788420.1 Homeobox 156..209 CDD:278475 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.