DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP004647

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_001231056.3 Gene:AgaP_AGAP004647 / 4576785 VectorBaseID:AGAP004647 Length:431 Species:Anopheles gambiae


Alignment Length:85 Identity:45/85 - (52%)
Similarity:52/85 - (61%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 DFNGPNGC--------PRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIW 445
            |.|..||.        ..:|.|..:|..|.:|||||||.|.||.|.||||:...|.|||||||||
Mosquito    18 DGNSSNGAFAADSYIGSTKRSRTAFTSSQLVELEKEFHSNRYLCRPRRIELTRKLALTERQIKIW 82

  Fly   446 FQNRRMKLKKELRAVKEINE 465
            |||||||.|||...:|.|::
Mosquito    83 FQNRRMKHKKESSNIKIISK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 35/51 (69%)
Abdominal-A 456..478 CDD:289192 3/10 (30%)
AgaP_AGAP004647XP_001231056.3 Homeobox 38..91 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.