Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002440.2 | Gene: | MSX2 / 4488 | HGNCID: | 7392 | Length: | 267 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 55/200 - (27%) |
---|---|---|---|
Similarity: | 76/200 - (38%) | Gaps: | 59/200 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 304 SVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPR 368
Fly 369 YPWMTLT----------DWMGSPFERVVCGDFNGPNGCPR---------------RRGRQTYTRF 408
Fly 409 QTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREE 473
Fly 474 QEKMK 478 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 25/51 (49%) |
Abdominal-A | 456..478 | CDD:289192 | 4/21 (19%) | ||
MSX2 | NP_002440.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..71 | 5/26 (19%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 116..147 | 7/39 (18%) | |||
Homeobox | 145..199 | CDD:365835 | 26/66 (39%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |