DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and MSX2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_002440.2 Gene:MSX2 / 4488 HGNCID:7392 Length:267 Species:Homo sapiens


Alignment Length:200 Identity:55/200 - (27%)
Similarity:76/200 - (38%) Gaps:59/200 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 SVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPR 368
            |:|.|..|..:.......|:.....:||||         |..:|.  ::.|.|.........|.:
Human    44 SLPFSVEALMSDKKPPKEASPLPAESASAG---------ATLRPL--LLSGHGAREAHSPGPLVK 97

  Fly   369 YPWMTLT----------DWMGSPFERVVCGDFNGPNGCPR---------------RRGRQTYTRF 408
             |:.|.:          .||..|      |.::.|   ||               |:.|..:|..
Human    98 -PFETASVKSENSEDGAAWMQEP------GRYSPP---PRHMSPTTCTLRKHKTNRKPRTPFTTS 152

  Fly   409 QTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREE 473
            |.|.||::|....||:...|.|.:.:|.|||.|:||||||||.|.|             |....|
Human   153 QLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAK-------------RLQEAE 204

  Fly   474 QEKMK 478
            .||:|
Human   205 LEKLK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 25/51 (49%)
Abdominal-A 456..478 CDD:289192 4/21 (19%)
MSX2NP_002440.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 5/26 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..147 7/39 (18%)
Homeobox 145..199 CDD:365835 26/66 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.