DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxc8

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001006787.1 Gene:hoxc8 / 448482 XenbaseID:XB-GENE-480999 Length:242 Species:Xenopus tropicalis


Alignment Length:248 Identity:79/248 - (31%)
Similarity:115/248 - (46%) Gaps:77/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 HPSS------HGGLSGMAGFTGLEDKSC--------SRYTDTVMNSYQSMSVPASA---SAQFAQ 315
            |||.      |.|.|.::. :|.:...|        |::       |...::|..:   :.|.|.
 Frog    51 HPSHHVQEFFHHGSSSLSN-SGFQQNPCALTCHGDASKF-------YGYEALPRQSLYGAQQEAS 107

  Fly   316 FYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGS 380
            ..|:....:|:.:..|.|.      |:.....:..:|                :|||.       
 Frog   108 VVQYPDCKSSSNTNTSEGQ------GHLNQNSSPSLM----------------FPWMR------- 143

  Fly   381 PFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIW 445
                        |:...||.|||||:|:|||||||||.||.||||:||||::|||.|||||:|||
 Frog   144 ------------PHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIW 196

  Fly   446 FQNRRMKLKKELRAVKEINEQAR----RDREEQEKMKAQETMKSAQQNKQVQQ 494
            |||||||.|||       |.:.:    ||.|:.|:...:|..|..:::|:.::
 Frog   197 FQNRRMKWKKE-------NNKDKLPGARDEEKTEEEGNEEEEKEEEESKESKE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 42/51 (82%)
Abdominal-A 456..478 CDD:289192 6/25 (24%)
hoxc8NP_001006787.1 Homeobox 153..206 CDD:365835 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.