DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and pax3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_012825755.1 Gene:pax3 / 448464 XenbaseID:XB-GENE-482740 Length:486 Species:Xenopus tropicalis


Alignment Length:230 Identity:54/230 - (23%)
Similarity:82/230 - (35%) Gaps:44/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 RRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK-----EL 457
            :||.|.|:|..|..|||:.|...||.....|.|:|....|||.::::||.|||.:.:|     :|
 Frog   221 QRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQAGANQL 285

  Fly   458 RAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQPQD-HH 521
            .|...:...|       ....|...:.:.|.::...|.....|.........|:.|...|.. |.
 Frog   286 MAFNHLIPGA-------FPPAAMPALPTYQLSETSYQPTSIPQAVSDPSNTVHRPQPLPPSSVHQ 343

  Fly   522 SIIAHNP-----------GHLHHSVVG--------QNDLKLGLGMGVGVGVGGIGPGIGG----- 562
            |.:..||           .|...|...        .|.:...:|.|:...|.|:....||     
 Frog   344 SSLPSNPESSSAYCLPSGRHGFSSYTDSFVPPSGPSNPMNPAIGNGLSPQVMGLLTNHGGVPHQP 408

  Fly   563 -------GLGGNLGMMSALDKSNHDLLKAVSKVNS 590
                   .|.|.|...:|:..|....|:.:..::|
 Frog   409 QTDYALSPLTGGLEPPTAVSASCSQRLEHMKSLDS 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 21/51 (41%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
pax3XP_012825755.1 PAX 35..162 CDD:238076
Homeobox 224..278 CDD:365835 21/53 (40%)
Pax7 349..393 CDD:372070 7/43 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.