DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and dlx5

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001004778.1 Gene:dlx5 / 447997 XenbaseID:XB-GENE-853057 Length:289 Species:Xenopus tropicalis


Alignment Length:278 Identity:59/278 - (21%)
Similarity:91/278 - (32%) Gaps:80/278 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 MNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMP-------- 353
            |.......|....:.:|.....|.:..:..:..::|...|..|.|.|...|..|...        
 Frog     1 MTGVYERRVATIRATEFQSIMHHPSQDSPTLPESTATDSGYYSPGGAAGHPHHGYCSPTSATYGK 65

  Fly   354 ----------GAGGAGGAGIADLPRYPWMTLTDW-MGSPF--ERVVCGDFNG------------- 392
                      |..||.|       .||....:|: .|||:  .....|.:|.             
 Frog    66 ALNAYQYQYHGMNGAAG-------NYPGKAYSDYGYGSPYHPHHQYSGAYNRVQPPSSQPEKEVS 123

  Fly   393 ------PNGCPR--RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNR 449
                  .||.|:  |:.|..|:.||...|::.|....||....|.|:|.:|.||:.|:||||||:
 Frog   124 EPEVRMVNGKPKKIRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNK 188

  Fly   450 RMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQ 514
            |.|:||.::                              |.::..:...................
 Frog   189 RSKIKKIMK------------------------------NGELPPEHSPSSSDPMACNSPQSPVV 223

  Fly   515 QQPQDHHSIIAHNPGHLH 532
            .:||.....::|:| |:|
 Frog   224 WEPQGSSRSLSHHP-HVH 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 0/21 (0%)
dlx5NP_001004778.1 DLL_N 26..118 CDD:315147 19/98 (19%)
Homeobox 140..193 CDD:306543 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.