DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and DBX2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001004329.2 Gene:DBX2 / 440097 HGNCID:33186 Length:339 Species:Homo sapiens


Alignment Length:327 Identity:84/327 - (25%)
Similarity:116/327 - (35%) Gaps:103/327 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 AAVASHGHAH------QQLLLTPPSAGNSQAGDS---------SCSPSPSASGSSSLHRSLNDNS 223
            :|||:|..|:      ..||..|.:.|....|.|         ..:|:|.....:       .:.
Human     4 SAVAAHAGAYWDVVASSALLNLPAAPGFGNLGKSFLIENLLRVGGAPTPRLQPPA-------PHD 61

  Fly   224 PGSASASASAS----AASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGG-LSGMAGFTG 283
            |.:|.|:|.|.    .||.|......||...|.:.| |....:.:....||:... |.|.|.   
Human    62 PATALATAGAQLRPLPASPVPLKLCPAAEQVSPAGA-PYGTRWAFQVLSPSADSARLPGRAP--- 122

  Fly   284 LEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPA 348
             .|:.|     |...|..:.|.|...|.  ..||          ||.         .|.:|.:||
Human   123 -GDRDC-----TFQPSAPAPSKPFLLST--PPFY----------SAC---------CGGSCRRPA 160

  Fly   349 SGVMPGAGGAGGAGIADLPR----YPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRG---RQTYT 406
            |...             .||    .|.:|              .|.|.    ..|||   |..::
Human   161 SSTA-------------FPREESMLPLLT--------------QDSNS----KARRGILRRAVFS 194

  Fly   407 RFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLK----KEL---RAVKEIN 464
            ..|...|||.|....|:::..|.::|..|.|.|.|:||||||||||.:    ||:   |.::|:.
Human   195 EDQRKALEKMFQKQKYISKTDRKKLAINLGLKESQVKIWFQNRRMKWRNSKEKEVLSNRCIQEVG 259

  Fly   465 EQ 466
            .|
Human   260 LQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 4/14 (29%)
DBX2NP_001004329.2 Homeobox 189..242 CDD:278475 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..318
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.