DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and meox1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001002450.2 Gene:meox1 / 436723 ZFINID:ZDB-GENE-040718-149 Length:253 Species:Danio rerio


Alignment Length:285 Identity:84/285 - (29%)
Similarity:105/285 - (36%) Gaps:57/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 SSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAA-----AAAAAAASSSFAIPTSK 260
            |||..||...|  :|...:  .||.|..:.|..........|.     ..|....|||..:|...
Zfish     6 SSCMRSPHTGG--ALWGCV--RSPHSGGSGAGIQPYQQAPFALHQKHDFLAYTDFSSSCLVPAPH 66

  Fly   261 MYPYVSN-HPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAA 324
            .||.... :|.:|.|                         ||......|......:..:....||
Zfish    67 AYPREDRLYPETHSG-------------------------YQRTEWQFSPCEPRGRGQEPCQGAA 106

  Fly   325 SAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVC-- 387
            .||.|....| |.|.|..|.|    |.:.|..........|         |:...|..:|.|.  
Zfish   107 EAVGAEMDSA-GGDRLAGAVT----GCLEGDYSPQSVPAVD---------TEKKSSKRKREVTDI 157

  Fly   388 --GDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRR 450
              ..|...:.|..|:.|..:|:.|..|||.||..::||||.||.|||..|.|||||:|:||||||
Zfish   158 QDSSFKADSNCKARKERTAFTKEQLRELEAEFTHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRR 222

  Fly   451 MKLKKELRAVKEINEQARRDREEQE 475
            ||.|:    ||.....:..|.|..|
Zfish   223 MKWKR----VKGGQPASPHDLEADE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 32/51 (63%)
Abdominal-A 456..478 CDD:289192 5/20 (25%)
meox1NP_001002450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..158 5/30 (17%)
Homeobox 174..226 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..253 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.