DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and CG15696

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster


Alignment Length:133 Identity:42/133 - (31%)
Similarity:60/133 - (45%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 PASGVMPGAGGA--GGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGP-NGCPRRRGRQTYTRF 408
            |||.|...:||:  ..|..|.:|.|.|:..|.:......|.:  ..|.| ...|.|..|..:|..
  Fly    42 PASYVSKESGGSPPASAAEAQIPVYDWLQYTRYHPPKLPRAL--RQNAPAKRTPGRLPRIPFTPQ 104

  Fly   409 QTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREE 473
            |...||..:..::||:.....::|.:|.||..::||||||||                ||..||:
  Fly   105 QLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRR----------------ARERREK 153

  Fly   474 QEK 476
            :||
  Fly   154 REK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 19/51 (37%)
Abdominal-A 456..478 CDD:289192 6/21 (29%)
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 15/46 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.