Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004518.1 | Gene: | MEOX1 / 4222 | HGNCID: | 7013 | Length: | 254 | Species: | Homo sapiens |
Alignment Length: | 252 | Identity: | 72/252 - (28%) |
---|---|---|---|
Similarity: | 100/252 - (39%) | Gaps: | 72/252 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 249 AASSSFAI--PTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASA 311
Fly 312 QFAQFYQHATAAASAVSAASAGAIGVDS-------------LGNACTQPASGVMPGAGGAGGAGI 363
Fly 364 ADLPRYPWMTLTDWMGSPFERVVCGDFNG-----------------------------PNGCPR- 398
Fly 399 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 31/51 (61%) |
Abdominal-A | 456..478 | CDD:289192 | 72/252 (29%) | ||
MEOX1 | NP_004518.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 86..178 | 20/106 (19%) | |
Homeobox | 175..227 | CDD:306543 | 31/51 (61%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 227..254 | 1/2 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |