DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and MEOX1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens


Alignment Length:252 Identity:72/252 - (28%)
Similarity:100/252 - (39%) Gaps:72/252 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 AASSSFAI--PTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASA 311
            ||||....  |.:.::..:.|..|...|.||:           ..|..|..:.:|.....|:|:|
Human     4 AASSCMRSLQPPAPVWGCLRNPHSEGNGASGL-----------PHYPPTPFSFHQKPDFLATATA 57

  Fly   312 QFAQFYQHATAAASAVSAASAGAIGVDS-------------LGNACTQPASGVMPGAGGAGGAGI 363
            .:..| ..:..||:..|......|..:.             :.:|..:|.||   .|||:...|.
Human    58 AYPDF-SASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSG---PAGGSKEMGT 118

  Fly   364 ADLPRYPWMTLTDWMGSPFERVVCGDFNG-----------------------------PNGCPR- 398
            :.|      .|.|..|.|      ||..|                             |.|..: 
Human   119 SSL------GLVDTTGGP------GDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKA 171

  Fly   399 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455
            |:.|..:|:.|..|||.||..::||||.||.|||..|.|:|||:|:||||||||.|:
Human   172 RKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 31/51 (61%)
Abdominal-A 456..478 CDD:289192 72/252 (29%)
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 20/106 (19%)
Homeobox 175..227 CDD:306543 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.