DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and cdx1a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_998001.2 Gene:cdx1a / 405762 ZFINID:ZDB-GENE-050510-1 Length:228 Species:Danio rerio


Alignment Length:211 Identity:66/211 - (31%)
Similarity:89/211 - (42%) Gaps:51/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 SCSRYTDTVMNS----YQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPA 348
            |.|...||.|..    :.::|.|            |.....||.....:|.....:|||......
Zfish     2 SVSYLLDTAMYGNPARHLNLSQP------------HLNVYPSAPYPDYSGYHPGPALGNDLHHTG 54

  Fly   349 SGVMPGAG-------------GAG------GAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPN 394
            |...||.|             |.|      |..::.||......|:   |:|.:|....|:...:
Zfish    55 SSWSPGFGPGSRDDWPPLYGHGTGHSLPANGVEVSVLPSVDQGLLS---GAPVDREEPQDWMRRS 116

  Fly   395 GCPRRRGRQT---------YTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRR 450
            ..|...|.:|         |:..|.|||||||||:.|:|.||:.|:|..|.|:|||:||||||||
Zfish   117 AVPTNPGGKTRTKDKYRVVYSDVQRLELEKEFHFSRYITIRRKAELAGTLNLSERQVKIWFQNRR 181

  Fly   451 MK----LKKELRAVKE 462
            .|    .||.|:.|::
Zfish   182 AKERKMNKKRLQQVQQ 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 32/64 (50%)
Abdominal-A 456..478 CDD:289192 2/7 (29%)
cdx1aNP_998001.2 Caudal_act 11..115 CDD:282574 24/118 (20%)
COG5576 <122..227 CDD:227863 37/76 (49%)
Homeobox 133..185 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.