DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and mnx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001009885.1 Gene:mnx1 / 405399 ZFINID:ZDB-GENE-040409-1 Length:311 Species:Danio rerio


Alignment Length:320 Identity:87/320 - (27%)
Similarity:128/320 - (40%) Gaps:80/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 LLLTPPSAGNSQAGDSSCSPSPSASGSSSLHRS--LNDNSPGSASASASASAASSVAAAAAAAAA 248
            |.:.||....|.....:..|:.|.|.||...::  |..||....:.|.|....||..        
Zfish    13 LAVDPPKVQTSPLALVTSLPTSSISSSSDSVQAVELTTNSDALQTESPSPPRISSCG-------- 69

  Fly   249 AASSSFAIPTSKMYPYVSNHPSSHGGLSGM--AGFTGLEDKSCSRYTDTVMNSYQSMSV---PA- 307
                  .||.    |...|.|  |.|:.|:  ...||:..::...:.   |.:|.:.::   || 
Zfish    70 ------LIPK----PGFLNSP--HSGMVGLHPQSSTGIPPQALYGHP---MYTYSAAALGQHPAL 119

  Fly   308 SASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWM 372
            |.|......:.|..:....::|:|.      .|.:......:|:|             ||:    
Zfish   120 SYSYPHGSHHHHHPSDPLKLTASSF------QLDHWLRVSTAGMM-------------LPK---- 161

  Fly   373 TLTDWMGSPFERVVCGDFNGP------NGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEI 431
                          ..||||.      ..|  ||.|..:|..|.||||.:|..|.||:|.:|.|:
Zfish   162 --------------MADFNGQAQSNLLGKC--RRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEV 210

  Fly   432 AHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQ 491
            |.:|.|||.|:||||||||||.|:.    |:..|||.:|.|:|:.....:.|...:::.|
Zfish   211 ATSLMLTETQVKIWFQNRRMKWKRS----KKAKEQAAQDAEKQKGKGNHDKMDGLEKDYQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 30/51 (59%)
Abdominal-A 456..478 CDD:289192 7/21 (33%)
mnx1NP_001009885.1 Homeobox 180..233 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.