DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and cdx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_989416.1 Gene:cdx1 / 395055 XenbaseID:XB-GENE-485396 Length:262 Species:Xenopus tropicalis


Alignment Length:247 Identity:75/247 - (30%)
Similarity:102/247 - (41%) Gaps:74/247 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 PYVSNHPSSH--GGLS-----GMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHA 320
            |..|:.||.|  .|::     |..|.|      .|.||.:..:.:.....|.::||..||     
 Frog    35 PQYSDFPSYHHVPGINSDPHHGQPGGT------WSSYTPSREDWHPYGPGPGASSANPAQ----- 88

  Fly   321 TAAASAVSAASAGAIGVDSLGNACTQPA--SGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFE 383
                  :|.:.:....|...|.....|:  |.|.|.:..|....:     |.||..|   |.|..
 Frog    89 ------ISFSPSDYNPVQPPGPGLLPPSLNSSVSPLSPSAQRRNL-----YEWMRRT---GVPTS 139

  Fly   384 RVVCGDFNGPNGCPRRRG--RQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWF 446
                   ...||..|.:.  |..||..|.||||||||::.|:|.||:.|:|.:|.|||||:||||
 Frog   140 -------TNSNGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAASLALTERQVKIWF 197

  Fly   447 QNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQ 498
            ||||.|.:|       :|:                        |::|||.||
 Frog   198 QNRRAKERK-------VNK------------------------KKMQQQSQQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 33/51 (65%)
Abdominal-A 456..478 CDD:289192 1/21 (5%)
cdx1NP_989416.1 Caudal_act 13..133 CDD:282574 28/119 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..120 21/94 (22%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P47902 152..173 12/20 (60%)
Homeobox 153..205 CDD:278475 33/51 (65%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000250|UniProtKB:P47902 191..202 9/10 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..262 9/47 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.