DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and cbx5

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_988907.2 Gene:cbx5 / 394502 XenbaseID:XB-GENE-972727 Length:200 Species:Xenopus tropicalis


Alignment Length:42 Identity:8/42 - (19%)
Similarity:19/42 - (45%) Gaps:3/42 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 WFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSA 486
            |..:|.:...:   .:.|..::.::.:|...|.|.:.|.:.|
 Frog    68 WEPDRNLDCPE---LISEFMKKYKKVKETDPKAKTESTKRKA 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 2/8 (25%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
cbx5NP_988907.2 CD_HP1alpha_Cbx5 37..85 CDD:349298 3/19 (16%)
CSD_HP1alpha_Cbx5 125..182 CDD:349302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.