powered by:
Protein Alignment abd-A and cbx5
DIOPT Version :9
Sequence 1: | NP_732176.1 |
Gene: | abd-A / 42037 |
FlyBaseID: | FBgn0000014 |
Length: | 590 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_988907.2 |
Gene: | cbx5 / 394502 |
XenbaseID: | XB-GENE-972727 |
Length: | 200 |
Species: | Xenopus tropicalis |
Alignment Length: | 42 |
Identity: | 8/42 - (19%) |
Similarity: | 19/42 - (45%) |
Gaps: | 3/42 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 445 WFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSA 486
|..:|.:...: .:.|..::.::.:|...|.|.:.|.:.|
Frog 68 WEPDRNLDCPE---LISEFMKKYKKVKETDPKAKTESTKRKA 106
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000007 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.