DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Dll

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster


Alignment Length:271 Identity:62/271 - (22%)
Similarity:89/271 - (32%) Gaps:93/271 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 AGDSSCSPSPSASGSSSLHRSLNDNSPG-SASASASASAASSVAAAAA-----AAAAAASSSFAI 256
            |.|:..:|.....|:::...:...|.|| ||.......||:......:     .......|.|..
  Fly     3 APDAPHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPS 67

  Fly   257 PTSKM-YPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHA 320
            |.|.: ||:...|.:|:.|..                    :.||    .|..||.....|    
  Fly    68 PRSALGYPFPPMHQNSYSGYH--------------------LGSY----APPCASPPKDDF---- 104

  Fly   321 TAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERV 385
                              |:.:.|..  ||:                                ||
  Fly   105 ------------------SISDKCED--SGL--------------------------------RV 117

  Fly   386 VCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRR 450
                 || .|...|:.|..|:..|..:|.:.|....||....|.|:|.:|.||:.|:||||||||
  Fly   118 -----NG-KGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRR 176

  Fly   451 MKLKKELRAVK 461
            .|.||.::|.:
  Fly   177 SKYKKMMKAAQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 1/6 (17%)
DllNP_001137759.1 Homeobox 127..180 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.