DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and ved

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_898897.1 Gene:ved / 368201 ZFINID:ZDB-GENE-030813-1 Length:278 Species:Danio rerio


Alignment Length:246 Identity:58/246 - (23%)
Similarity:97/246 - (39%) Gaps:58/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 SASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTG---LEDKSCSR 291
            |.|:|:.......::.:..:...|::..||   |::..|....        :|.   |::||..:
Zfish    11 SQSSSSVRDEQQTSSTSTDSLPGSYSRWTS---PHMEKHMEEK--------YTEEKYLQEKSMEK 64

  Fly   292 YTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAV---SAASAGAIGVDSLGNACTQPAS--GV 351
            :........:.|....:...:. |.:.|.:..:|:.   ..:...:.|..|.|:....||:  .|
Zfish    65 FMHEKYTEEKHMPEKYTEGKRI-QKHTHESGFSSSTEDEELSGCESEGSRSEGSGSRSPAAPGSV 128

  Fly   352 MPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKE 416
            .|.:|.                     |||           .:|   ||.|..::..|...||:.
Zfish   129 APASGS---------------------GSP-----------SSG---RRPRTAFSSEQISSLERV 158

  Fly   417 FHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQA 467
            |..|.||..:.:.|:...|.||::||:.||||||||||   |.|::...||
Zfish   159 FKRNAYLGAQDKAELCRTLKLTDKQIRNWFQNRRMKLK---RTVQDSLAQA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 22/51 (43%)
Abdominal-A 456..478 CDD:289192 4/12 (33%)
vedNP_898897.1 Homeobox 145..196 CDD:278475 21/50 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.