DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment abd-A and ISL1

DIOPT Version :9

Sequence 1:	NP_732176.1	Gene:	abd-A / 42037	FlyBaseID:	FBgn0000014	Length:	590	Species:	Drosophila melanogaster
Sequence 2:	NP_002193.2	Gene:	ISL1 / 3670	HGNCID:	6132	Length:	349	Species:	Homo sapiens

Alignment Length:	107	Identity:	26/107 - (24%)
Similarity:	47/107 - (43%)	Gaps:	7/107 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   406 TRFQTLELEKEFHF--NHYLTRRR-----RIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEI 463
            ||.:|:..||:.|.  ..|....|     :.::.....|:.|.|::||||:|.|.||....:|::
Human   182 TRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQL 246

  Fly   464 NEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQ 505
            .:|...|:...:.|.....:.::.:......|....:.|..|
Human   247 QQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQ 288

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
abd-A	NP_732176.1	Homeobox	402..454	CDD:278475	17/54 (31%)
abd-A	NP_732176.1	Abdominal-A	456..478	CDD:289192	3/21 (14%)
ISL1	NP_002193.2	LIM1_Isl	17..71	CDD:188752
		LIM domain	20..73
		LIM2_Isl	79..133	CDD:188760
		LIM domain	82..136
		HOX	181..237	CDD:197696	17/54 (31%)
		Homeodomain	184..243		17/58 (29%)
		LIM-binding domain (LID). /evidence=ECO:0000250	262..291		3/27 (11%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	312..349
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910