DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment abd-A and PDX1

DIOPT Version :9

Sequence 1:	NP_732176.1	Gene:	abd-A / 42037	FlyBaseID:	FBgn0000014	Length:	590	Species:	Drosophila melanogaster
Sequence 2:	NP_000200.1	Gene:	PDX1 / 3651	HGNCID:	6107	Length:	283	Species:	Homo sapiens

Alignment Length:	127	Identity:	55/127 - (43%)
Similarity:	65/127 - (51%)	Gaps:	26/127 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   343 ACTQPASGVMP-GAGGAGGAGIADLPR-----YPWMTLT-------DWMGSPFERVVCGDFNGPN 394
            |...|.:|..| ||    ..|:.:.|.     :|||..|       .|.|..:..       .|.
Human    91 ALPHPPAGPFPEGA----EPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAA-------EPE 144

  Fly   395 GCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456
              ..:|.|..|||.|.|||||||.||.|::|.||:|:|..|.||||.|||||||||||.|||
Human   145 --ENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKE 204

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
abd-A	NP_732176.1	Homeobox	402..454	CDD:278475	36/51 (71%)
abd-A	NP_732176.1	Abdominal-A	456..478	CDD:289192	1/1 (100%)
PDX1	NP_000200.1	Transactivation domain. /evidence=ECO:0000250	13..73
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	34..71
		Antp-type hexapeptide	118..123		2/4 (50%)
		Homeobox	149..202	CDD:278475	36/52 (69%)
		Nuclear localization signal. /evidence=ECO:0000250	197..203		4/5 (80%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	201..283		3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810