DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Gsx2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001131035.2 Gene:Gsx2 / 364140 RGDID:1308047 Length:305 Species:Rattus norvegicus


Alignment Length:517 Identity:118/517 - (22%)
Similarity:167/517 - (32%) Gaps:240/517 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSK-FVFDSML--------PKYPQFQP----FISSHHLTTTPPNSSSAAVAAALAAAAASASASV 52
            ||: |..||::        |..|:..|    ||        |....|..|.:.......|..:..
  Rat     1 MSRSFYVDSLIIKDSSRPAPSLPESHPGPDFFI--------PLGMPSPLVMSVSGPGCPSRKSGA 57

  Fly    53 ----SASSSSNNNSSNTIAGSNTSNTNNSSSSPSSSSNNNSNLNLSGGSLSPSHLSQHLGQSPHS 113
                ....:|:.:||...||:....|..:.::            ::||.::....:..|.:|..|
  Rat    58 FCVCPLCVTSHLHSSRPPAGAGGGATGTAGAA------------VAGGGVAGGTGALPLLKSQFS 110

  Fly   114 PVSSSSPFQQHHPQVQQQHLNHQQQQHLHHQQQQHHHQYSSLSAALQLQQQQHHISKLAAAAVAS 178
            |....:.|   .|:|  .|.:|      ||...||||               ||           
  Rat   111 PGPGDAQF---CPRV--SHAHH------HHHAPQHHH---------------HH----------- 138

  Fly   179 HGHAHQQLLLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAA 243
              |..||                                      ||||:|:|:|      ||||
  Rat   139 --HQPQQ--------------------------------------PGSAAAAAAA------AAAA 157

  Fly   244 AAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPAS 308
            ||||||.                .||..|                                .|..
  Rat   158 AAAAAAL----------------GHPQHH--------------------------------APVC 174

  Fly   309 ASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMT 373
            |:..:                                                .::|..|:..:|
  Rat   175 AATTY------------------------------------------------NVSDPRRFHCLT 191

  Fly   374 LTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLT 438
            :.   ||...:|       |||   :|.|..:|..|.||||:||..|.||:|.||||||..|.|:
  Rat   192 MG---GSDTSQV-------PNG---KRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLS 243

  Fly   439 ERQIKIWFQNRRMKLKKELR--------AVKEINEQARRDREEQEKMKAQETMKSAQQNKQV 492
            |:|:||||||||:|.|||.:        :.|.:..||...|.|.|...:.   .||.::|::
  Rat   244 EKQVKIWFQNRRVKHKKEGKGASRNNHASCKCVGSQAHYARSEDEDSLSP---ASANEDKEI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 32/51 (63%)
Abdominal-A 456..478 CDD:289192 7/29 (24%)
Gsx2NP_001131035.2 Homeobox 207..260 CDD:395001 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.