DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Meox1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001102307.1 Gene:Meox1 / 363684 RGDID:1308911 Length:253 Species:Rattus norvegicus


Alignment Length:293 Identity:73/293 - (24%)
Similarity:104/293 - (35%) Gaps:111/293 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAAS 251
            |..|.|.|:|.:|.....|:|     .|.|:  ..:.|.:|   |....::|..||...:...|.
  Rat    22 LRNPHSEGSSASGLPHYPPTP-----FSFHQ--KSDFPATA---AYPDFSTSCLAATPHSLPRAE 76

  Fly   252 SSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQF 316
            ..|    ::.:|.....|..|..:| .||                    |.:::..:.||:    
  Rat    77 RIF----NEQHPAFPQTPDWHFPIS-EAG--------------------QRLNLGPAGSAR---- 112

  Fly   317 YQHATAAASAVSAASAGAI-GVDSLGNAC----------------------TQPASGVMPGAGGA 358
                     .:.|.|.|.: |...||..|                      ..|.:|        
  Rat   113 ---------EMGAGSPGLVDGTGGLGEDCMVLGTIAHETEKKLSRRKKERSDNPENG-------- 160

  Fly   359 GGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPR-RRGRQTYTRFQTLELEKEFHFNHY 422
            ||.                               |.|..: |:.|..:|:.|..|||.||..::|
  Rat   161 GGK-------------------------------PEGSSKARKERTAFTKEQLRELEAEFAHHNY 194

  Fly   423 LTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455
            |||.||.|||..|.|:|||:|:||||||||.|:
  Rat   195 LTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 31/51 (61%)
Abdominal-A 456..478 CDD:289192 73/293 (25%)
Meox1NP_001102307.1 COG5576 139..251 CDD:227863 39/128 (30%)
Homeobox 174..227 CDD:395001 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.