DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hmx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001101833.2 Gene:Hmx1 / 360960 RGDID:1304928 Length:333 Species:Rattus norvegicus


Alignment Length:110 Identity:38/110 - (34%)
Similarity:51/110 - (46%) Gaps:16/110 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 PGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEF 417
            |.|||...|.:|:.|                .|.........|..|::.|..::|.|..:||..|
  Rat   163 PAAGGEEAAELAEAP----------------AVAAAAAGEARGGRRKKTRTVFSRSQVFQLESTF 211

  Fly   418 HFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKE 462
            ....||:...|..:|.:|.|||.|:||||||||.|.|::|.|..|
  Rat   212 DLKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKRQLAAELE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 24/51 (47%)
Abdominal-A 456..478 CDD:289192 3/7 (43%)
Hmx1NP_001101833.2 Homeobox 195..249 CDD:395001 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.