DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and cad

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:468 Identity:107/468 - (22%)
Similarity:157/468 - (33%) Gaps:154/468 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SHHLTTTPPNSSSAAVAAALAAAAASASASVSASSSSNNNSSNTIAGSNTSNTNNSSSSPSSSSN 86
            ||:..|.|.....:|...|.|:|                      ||...:.|.|...:|.    
  Fly     3 SHYYNTLPYTQKHSAANLAYASA----------------------AGQPWNWTPNYHHTPP---- 41

  Fly    87 NNSNLNLSGGSLSPSHLSQHLGQSP---------------------HSPVSSSSP-FQQHHPQVQ 129
            |:..|    |.:..||.:.|...:.                     |||.||::. |.|:.|   
  Fly    42 NHQFL----GDVDSSHAAHHAAAAHQMYYNSHHMFHSAAAASAGEWHSPASSTADNFVQNVP--- 99

  Fly   130 QQHLNHQQQQHLHHQQQQHHHQYSSLSAALQLQQQQHHISKLAAAAVASHGHAHQQLLLTPPSAG 194
                     ...|...|||||.::            |..|..|::..:|.|.|          .|
  Fly   100 ---------TSAHQLMQQHHHHHA------------HASSSSASSGSSSSGGA----------PG 133

  Fly   195 NSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTS 259
            ..|..:::.|.....:|.........|..||||..:.....|..:.:.....:.:..||...|||
  Fly   134 APQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSPGAPTS 198

  Fly   260 KMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAA 324
            ...|:  :|.:.|  ||.:|. ....:.:.:....|..|:..:.||.                  
  Fly   199 ASSPH--HHLAHH--LSAVAN-NNNNNNNNNNSPSTHNNNNNNNSVS------------------ 240

  Fly   325 SAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSP-------- 381
                            .|..|.|:..                |.:.||....:...|        
  Fly   241 ----------------NNNRTSPSKP----------------PYFDWMKKPAYPAQPQPDLSSSP 273

  Fly   382 -FERVVCGDFNGPNGCPRRRG--RQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIK 443
             .|.:  .|....:|..|.:.  |..||.||.||||||:..:.|:|.||:.|:|..|.|:|||:|
  Fly   274 NLEDL--SDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVK 336

  Fly   444 IWFQNRRMKLKKE 456
            |||||||.|.:|:
  Fly   337 IWFQNRRAKERKQ 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 31/51 (61%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
cadNP_001260641.1 Homeobox 295..347 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.