Protein Alignment abd-A and pnx

DIOPT Version :9

• Sequence 1: NP_732176.1
• Gene: abd-A / 42037
• FlyBaseID: FBgn0000014
• Length: 590
• Species: Drosophila melanogaster
• Sequence 2: NP_840087.1
• Gene: pnx / 352939
• ZFINID: ZDB-GENE-030328-42
• Length: 182
• Species: Danio rerio
• Alignment Length: 59
• Identity: 31/59 - (52%)
• Similarity: 38/59 - (64%)
• Gaps: 0/59 - (0%)

  Fly   399 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKEL 457
            :|.|..:|..|...||:.|..:|||:...|..||.||.|:|.|:||||||||.|.||||
Zfish    68 KRIRTAFTLDQLRILERSFQSSHYLSVFERHCIASALGLSETQVKIWFQNRRTKWKKEL 126

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
abd-A	NP_732176.1	Homeobox	402..454	CDD:278475	26/51 (51%)
		Abdominal-A	456..478	CDD:289192	2/2 (100%)
pnx	NP_840087.1	Important for interaction with tle3a. /evidence=ECO:0000269|PubMed:12642490	1..34
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	24..63
		Homeobox	71..123	CDD:278475	26/51 (51%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900