DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HMX3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001099044.1 Gene:HMX3 / 340784 HGNCID:5019 Length:357 Species:Homo sapiens


Alignment Length:339 Identity:90/339 - (26%)
Similarity:119/339 - (35%) Gaps:119/339 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPSAGNSQAGDSSCSPSPSASGSS--SLHRSLNDN--------SPGSASASASASAASSVAAAAA 244
            |.:||.:.|......|.|.|...|  |:...||.:        .|...:..|.||||   |||||
Human     6 PDAAGTASAQPQPPPPPPPAPKESPFSIKNLLNGDHHRPPPKPQPPPRTLFAPASAA---AAAAA 67

  Fly   245 AAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASA 309
            ||||||.                     |.|.|.|||      :.|:..|.   ::....:||..
Human    68 AAAAAAK---------------------GALEGAAGF------ALSQVGDL---AFPRFEIPAQR 102

  Fly   310 SAQFAQFYQHATAAASAVSAASAG-----------AIGVDSLGNACTQPASG------------- 350
            .|..|.:.:.:.|.....:...||           |:..||      .||||             
Human   103 FALPAHYLERSPAWWYPYTLTPAGGHLPRPEASEKALLRDS------SPASGTDRDSPEPLLKAD 161

  Fly   351 -----------------------------VMPGAGGAGGAGIADLPRYPWMTLTDW---MGSPFE 383
                                         ..|||.||.....|..|     ...||   ..||.:
Human   162 PDHKELDSKSPDEIILEESDSEESKKEGEAAPGAAGASVGAAAATP-----GAEDWKKGAESPEK 221

  Fly   384 RVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQN 448
            :         ..|.:::.|..::|.|..:||..|....||:...|..:|.:|.|||.|:||||||
Human   222 K---------PACRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQN 277

  Fly   449 RRMKLKKELRAVKE 462
            ||.|.|::|.|..|
Human   278 RRNKWKRQLAAELE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 24/51 (47%)
Abdominal-A 456..478 CDD:289192 3/7 (43%)
HMX3NP_001099044.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 12/51 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..229 19/119 (16%)
Homeobox 230..283 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.