DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP008980

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_552873.2 Gene:AgaP_AGAP008980 / 3291866 VectorBaseID:AGAP008980 Length:267 Species:Anopheles gambiae


Alignment Length:190 Identity:41/190 - (21%)
Similarity:65/190 - (34%) Gaps:59/190 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 HATAAASAVSAAS--------AGAIGVDSLGNAC-------TQPASGVMPGAGGAGGA------- 361
            |.|...|||...|        |...|:..:...|       |.|.:.:.|......|.       
Mosquito    47 HYTIRDSAVFCRSHIELPLEAATTPGLPGMPMQCPYQSQYGTSPVAPLSPSDSTTSGGKLNPATY 111

  Fly   362 ----GIADLPRYP---------------WMTL-----TDWMGSPFERVVCGDFNGPNGCPR-RRG 401
                |:..||:.|               .||.     |:::...|.|       |.....| :|.
Mosquito   112 YPPHGVTGLPQQPRQKGRPRKRKPKDIEAMTASLDLNTEYLDLGFSR-------GLGSSSRAKRM 169

  Fly   402 RQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQN-----RRMKLKKE 456
            |.::...|...::..|..||....:...:::....|.:|.:::||||     |||.:|:|
Mosquito   170 RTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 14/56 (25%)
Abdominal-A 456..478 CDD:289192 1/1 (100%)
AgaP_AGAP008980XP_552873.2 LIM2_Lhx2_Lhx9 3..61 CDD:188763 6/13 (46%)
Homeobox 170..222 CDD:278475 11/51 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.