DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP005346

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_555988.2 Gene:AgaP_AGAP005346 / 3289950 VectorBaseID:AGAP005346 Length:461 Species:Anopheles gambiae


Alignment Length:248 Identity:63/248 - (25%)
Similarity:100/248 - (40%) Gaps:55/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 SASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRY 292
            ::|...|..||:......|.....:||:|......|..|...|:    |....:.|::|:..|.|
Mosquito     2 ASSVVNSTPSSMHPVDPVANNRVKNSFSIEHLLAKPDRSGTAST----SSAGCYRGMDDRLASSY 62

  Fly   293 ----TDTVMNS--YQSMSVPASASAQFAQFYQHATAAA----------SAVSAASAGAIGVDSLG 341
                ...:.||  ||::...::::.:|....::.|:|.          .|.|::...:...|::.
Mosquito    63 PIAHPAQLHNSMVYQTLMTRSASAVEFLDVNKNETSAVPFAADRPPSERAESSSPESSCNEDTMD 127

  Fly   342 NACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYT 406
            | |::.||     .|.|.|...|...|                             ::|.|..::
Mosquito   128 N-CSEIAS-----EGSASGGLAAHDDR-----------------------------KKRPRTAFS 157

  Fly   407 RFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRA 459
            ..|...||.||....||:..:|..:|..|.|||.||||||||||.|.|::..|
Mosquito   158 AAQIKALETEFERGKYLSVAKRTALAKQLHLTETQIKIWFQNRRTKWKRKYTA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 25/51 (49%)
Abdominal-A 456..478 CDD:289192 1/4 (25%)
AgaP_AGAP005346XP_555988.2 Homeobox 152..205 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.