DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and OdsH

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster


Alignment Length:336 Identity:83/336 - (24%)
Similarity:126/336 - (37%) Gaps:61/336 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 GSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSC 289
            |.......:||....|||||.....:..|..:..|...|.....|:|             ...|.
  Fly    16 GQVQHPHGSSALQLYAAAAAVNMQVSGWSSVLNLSMDAPNPEISPNS-------------VTNSS 67

  Fly   290 SRYTDTVMNSYQSMSVPASASA-QFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMP 353
            |.|....|...|...|.|:|.| |..|..|........:...|...|.:||:     .|...:..
  Fly    68 SVYMIRQMALIQQARVAAAAVAMQQQQQQQRDLNRELGMDPHSEQRIKLDSV-----SPTHNIHA 127

  Fly   354 GAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFN-GPNGC----PRRRGRQTYTRFQTLEL 413
            |:    ..||...|      |:| .|:        |.| |.|.|    .:||||..:..:|..||
  Fly   128 GS----SRGIKQDP------LSD-EGA--------DSNLGQNDCTESSKKRRGRTNFNSWQLREL 173

  Fly   414 EKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQ---- 474
            |:.|..:||.....|..:|..|.|.|.:|.:||||||.|.:|:....|.....|.....:.    
  Fly   174 ERVFQGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEHTKKGPGRPAHNAHPQSCSGD 238

  Fly   475 ----EKMKAQE-TMKSAQQNKQVQQQQQQQQQQ------QQQQQQQHQQQQQQPQDHHSIIAHNP 528
                .:::|:| ..:|.:..|.:.:|.::.|.:      .:.:.:.....|:...|.::.: .:.
  Fly   239 PIPLSELRARELAQRSKRMKKAIDRQAKKLQDKGLEVDYARLEAEYLAAHQENGVDENNWL-DDD 302

  Fly   529 GH--LHHSVVG 537
            |:  ||..|||
  Fly   303 GYDDLHIDVVG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 21/51 (41%)
Abdominal-A 456..478 CDD:289192 2/29 (7%)
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.