DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hlx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_009293289.1 Gene:hlx1 / 327096 ZFINID:ZDB-GENE-030131-5304 Length:357 Species:Danio rerio


Alignment Length:373 Identity:90/373 - (24%)
Similarity:137/373 - (36%) Gaps:98/373 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 LTPPSAGNSQAGDSSCS--------PSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAA 244
            |.|..|.|.....:.||        ..||...:..||....:|..||          ||:.|...
Zfish     6 LNPFYASNFSLWTAYCSAGFAVDSMKKPSFCIADILHVGDAENIQGS----------SSLMAHIG 60

  Fly   245 AAAAAASSSFAIPTSKMYPYVSNHPS--SHG-GLSGMAGF-------------------TGLEDK 287
            |.|...||...:..|.:.|....||:  .|| .|:..|..                   |..|.|
Zfish    61 ARAQVHSSGSPLRPSPVTPDARLHPAYLRHGIHLTSRAAINAPPPTSKDLKFGIDRILSTDFEPK 125

  Fly   288 S----CSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPA 348
            |    ..|...::::..:..:|..|||..||......:..:|.:.          |:|||..|  
Zfish   126 SKESPSLRDLTSIVSPNRQSAVHVSASPYFASIDPTMSETSSLMG----------SIGNAARQ-- 178

  Fly   349 SGVMPGAGGAGGAGIAD-LPRYPWMTLT-DWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTL 411
                     :|.....| .|..|:..|: |.|...::|            .|...|..::..|..
Zfish   179 ---------SGQHQFQDTFPGRPYAVLSKDTMPQTYKR------------KRSWSRAVFSNLQRK 222

  Fly   412 ELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDRE-EQE 475
            .|||.|....|:|:..|.::|..|.||:.|:|:||||||||.:....|      ||::|:| ||.
Zfish   223 GLEKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEA------QAQKDKEKEQP 281

  Fly   476 KMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQPQDHHSI 523
            ...|.||            :|:::...:.:.:....:.:..|:|...:
Zfish   282 DKSAAET------------EQKERDDSECETEPSESEFEDGPEDKSDV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 7/22 (32%)
hlx1XP_009293289.1 Homeobox 212..265 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.