DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HOXD3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_008829.3 Gene:HOXD3 / 3232 HGNCID:5137 Length:432 Species:Homo sapiens


Alignment Length:253 Identity:77/253 - (30%)
Similarity:107/253 - (42%) Gaps:65/253 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 GLSGMAGFTGLEDKSCSRYTDTVMNS--YQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIG 336
            ||.|..|:        |:.|||...|  :|....||:||:....:...|.:..|:....:....|
Human    27 GLFGGYGY--------SKTTDTYGYSTPHQPYPPPAAASSLDTDYPGSACSIQSSAPLRAPAHKG 83

  Fly   337 VDSLGNACTQPASGVMPGAGGA------------------------------GGAGIADLPR--- 368
            .: |..:|.:|.:|...|.||.                              ||...|..|:   
Human    84 AE-LNGSCMRPGTGNSQGGGGGSQPPGLNSEQQPPQPPPPPPTLPPSSPTNPGGGVPAKKPKGGP 147

  Fly   369 -------------YPWMTLTDWMGSPFERVVCG------DFNGPNGCPRRRGRQTYTRFQTLELE 414
                         :|||  .:...:..::..|.      :...|.|...:|.|..||..|.:|||
Human   148 NASSSSATISKQIFPWM--KESRQNSKQKNSCATAGESCEDKSPPGPASKRVRTAYTSAQLVELE 210

  Fly   415 KEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDRE 472
            ||||||.||.|.||:|:|:.|.||||||||||||||||.||:.:|...::..|.:..|
Human   211 KEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGILHSPASQSPE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 37/51 (73%)
Abdominal-A 456..478 CDD:289192 3/17 (18%)
HOXD3NP_008829.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..62 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..197 19/131 (15%)
Antp-type hexapeptide 160..165 3/6 (50%)
Homeobox 198..250 CDD:306543 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..280 3/16 (19%)
DUF4074 369..430 CDD:315871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.