Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_008829.3 | Gene: | HOXD3 / 3232 | HGNCID: | 5137 | Length: | 432 | Species: | Homo sapiens |
Alignment Length: | 253 | Identity: | 77/253 - (30%) |
---|---|---|---|
Similarity: | 107/253 - (42%) | Gaps: | 65/253 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 274 GLSGMAGFTGLEDKSCSRYTDTVMNS--YQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIG 336
Fly 337 VDSLGNACTQPASGVMPGAGGA------------------------------GGAGIADLPR--- 368
Fly 369 -------------YPWMTLTDWMGSPFERVVCG------DFNGPNGCPRRRGRQTYTRFQTLELE 414
Fly 415 KEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDRE 472 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 37/51 (73%) |
Abdominal-A | 456..478 | CDD:289192 | 3/17 (18%) | ||
HOXD3 | NP_008829.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 43..62 | 6/18 (33%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 68..197 | 19/131 (15%) | |||
Antp-type hexapeptide | 160..165 | 3/6 (50%) | |||
Homeobox | 198..250 | CDD:306543 | 37/51 (73%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 253..280 | 3/16 (19%) | |||
DUF4074 | 369..430 | CDD:315871 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 400..432 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |