DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HOXD1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_078777.1 Gene:HOXD1 / 3231 HGNCID:5132 Length:328 Species:Homo sapiens


Alignment Length:280 Identity:84/280 - (30%)
Similarity:114/280 - (40%) Gaps:49/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 GNSQAGDSSC--------SPSPSASGSSSLHRSLNDNSPGSAS---ASASASAASSVAAAAAAAA 247
            ||......||        ||||.|:.:       ..:.|..|:   |..:...|....||.||||
Human    44 GNGDGAFVSCLPLAAARPSPSPPAAPA-------RPSVPPPAAPQYAQCTLEGAYEPGAAPAAAA 101

  Fly   248 AAASSSFAIPTSKMYPYVSNHPS-SHGGLSGMAGFTGLEDKSCSRY-TDTVMNSYQSMSVPASAS 310
            ..|.          |.::.:.|: ...|:.|.|...|   .|...| |..|.:...|..:  |..
Human   102 GGAD----------YGFLGSGPAYDFPGVLGRAADDG---GSHVHYATSAVFSGGGSFLL--SGQ 151

  Fly   311 AQFAQFYQHATAAASAVSAASA--GAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMT 373
            ..:|.|.:.....|...::|..  ||....|       ||.|..|.:........|....:.||.
Human   152 VDYAAFGEPGPFPACLKASADGHPGAFQTAS-------PAPGTYPKSVSPASGLPAAFSTFEWMK 209

  Fly   374 LTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLT 438
            :   ..:..::....::...:  |....|..::..|..|||||||||.||||.||||||:.|.|.
Human   210 V---KRNASKKGKLAEYGAAS--PSSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLHLN 269

  Fly   439 ERQIKIWFQNRRMKLKKELR 458
            :.|:||||||||||.||..|
Human   270 DTQVKIWFQNRRMKQKKRER 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 34/51 (67%)
Abdominal-A 456..478 CDD:289192 1/3 (33%)
HOXD1NP_078777.1 Antp-type hexapeptide 204..209 1/4 (25%)
Homeobox 233..285 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.