DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HOXC8

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_073149.1 Gene:HOXC8 / 3224 HGNCID:5129 Length:242 Species:Homo sapiens


Alignment Length:257 Identity:77/257 - (29%)
Similarity:122/257 - (47%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 YPYVSNHPSS--HGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAA 324
            :.:.|:|...  |.|.||::. :|.:...|            |:|....||    :||.:.....
Human    49 FQHASHHVQDFFHHGTSGISN-SGYQQNPC------------SLSCHGDAS----KFYGYEALPR 96

  Fly   325 SAVSAASAGAIGV---DSLGNACTQPASGVMPGAGGAGGAGIADLP--RYPWMTLTDWMGSPFER 384
            .::..|...|..|   |...:|.|..:.       |.|.......|  .:|||.           
Human    97 QSLYGAQQEASVVQYPDCKSSANTNSSE-------GQGHLNQNSSPSLMFPWMR----------- 143

  Fly   385 VVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNR 449
                    |:...||.|||||:|:|||||||||.||.||||:||||::|||.|||||:|||||||
Human   144 --------PHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNR 200

  Fly   450 RMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQ 511
            |||.|||                     ..::.:..|:..::|:::..::::::::::::::
Human   201 RMKWKKE---------------------NNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 42/51 (82%)
Abdominal-A 456..478 CDD:289192 1/21 (5%)
HOXC8NP_073149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..154 12/65 (18%)
Antp-type hexapeptide 138..143 2/4 (50%)
Homeobox 153..205 CDD:306543 42/51 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..242 4/57 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2996
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.