DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HOXC6

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_004494.1 Gene:HOXC6 / 3223 HGNCID:5128 Length:235 Species:Homo sapiens


Alignment Length:129 Identity:65/129 - (50%)
Similarity:78/129 - (60%) Gaps:26/129 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 ADLPRYPWM-TLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRR 427
            |.:..|||| .:....|..:            |..||||||.|:|:||||||||||||.||||||
Human   118 ASIQIYPWMQRMNSHSGVGY------------GADRRRGRQIYSRYQTLELEKEFHFNRYLTRRR 170

  Fly   428 RIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEIN-------------EQARRDREEQEKMK 478
            |||||:|||||||||||||||||||.|||......::             ::.:|:..|:||.|
Human   171 RIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 46/51 (90%)
Abdominal-A 456..478 CDD:289192 5/34 (15%)
HOXC6NP_004494.1 Antp-type hexapeptide 122..127 3/4 (75%)
Homeobox 145..198 CDD:395001 46/52 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..235 5/35 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.