Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061826.1 | Gene: | HOXC5 / 3222 | HGNCID: | 5127 | Length: | 222 | Species: | Homo sapiens |
Alignment Length: | 257 | Identity: | 87/257 - (33%) |
---|---|---|---|
Similarity: | 103/257 - (40%) | Gaps: | 108/257 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 296 VMNSY--QSMSVPA----------SASAQFAQFYQHATAAASAV---SAASAGAIGVDSLGN--- 342
Fly 343 -----ACTQPAS-GVMPGAGGAG-----------------------------------GAGIADL 366
Fly 367 PR----YPWMTL------TDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNH 421
Fly 422 YLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETM 483 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 44/51 (86%) |
Abdominal-A | 456..478 | CDD:289192 | 1/21 (5%) | ||
HOXC5 | NP_061826.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 68..141 | 10/72 (14%) | |
Antp-type hexapeptide | 140..145 | 3/4 (75%) | |||
Homeobox | 158..211 | CDD:306543 | 44/52 (85%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45659 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.910 |