DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HOXC5

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens


Alignment Length:257 Identity:87/257 - (33%)
Similarity:103/257 - (40%) Gaps:108/257 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 VMNSY--QSMSVPA----------SASAQFAQFYQHATAAASAV---SAASAGAIGVDSLGN--- 342
            |.||:  ||.::||          |||...|..|.:.....|..   .|.|....|||...|   
Human     5 VANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRA 69

  Fly   343 -----ACTQPAS-GVMPGAGGAG-----------------------------------GAGIADL 366
                 ||:..|: |..||...|.                                   .||::..
Human    70 HPDRPACSAAAAPGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQP 134

  Fly   367 PR----YPWMTL------TDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNH 421
            |.    |||||.      ||                     .:|.|.:|||:||||||||||||.
Human   135 PAPPQIYPWMTKLHMSHETD---------------------GKRSRTSYTRYQTLELEKEFHFNR 178

  Fly   422 YLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETM 483
            |||||||||||:.|||.||||||||||||||.||:                  .|||::|.:
Human   179 YLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKD------------------SKMKSKEAL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 44/51 (86%)
Abdominal-A 456..478 CDD:289192 1/21 (5%)
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 10/72 (14%)
Antp-type hexapeptide 140..145 3/4 (75%)
Homeobox 158..211 CDD:306543 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.