Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_076922.1 | Gene: | HOXB9 / 3219 | HGNCID: | 5120 | Length: | 250 | Species: | Homo sapiens |
Alignment Length: | 247 | Identity: | 72/247 - (29%) |
---|---|---|---|
Similarity: | 100/247 - (40%) | Gaps: | 94/247 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 290 SRYTDTVMNSYQSMSVPAS--ASAQFAQFYQ--HAT-----------------AAASAVSAASAG 333
Fly 334 AIGVDSLGNACTQPASGVMP-----------------GAGGAGGAGIADLPRYPWMTLTDWMGSP 381
Fly 382 FERVVCG--------------------------------------DFNGP-----NGCPRRRGRQ 403
Fly 404 TYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 37/51 (73%) |
Abdominal-A | 456..478 | CDD:289192 | 72/247 (29%) | ||
HOXB9 | NP_076922.1 | Hox9_act | 1..172 | CDD:282473 | 30/175 (17%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 21..47 | 7/25 (28%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 149..182 | 2/32 (6%) | |||
Homeobox | 188..241 | CDD:278475 | 37/52 (71%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |