DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HOXB9

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_076922.1 Gene:HOXB9 / 3219 HGNCID:5120 Length:250 Species:Homo sapiens


Alignment Length:247 Identity:72/247 - (29%)
Similarity:100/247 - (40%) Gaps:94/247 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 SRYTDTVMNSYQSMSVPAS--ASAQFAQFYQ--HAT-----------------AAASAVSAASAG 333
            |.|.|::: |::|...|.:  .|.|:|...|  ||.                 |:.:.:|..::|
Human     9 SYYVDSII-SHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASG 72

  Fly   334 AIGVDSLGNACTQPASGVMP-----------------GAGGAGGAGIADLPRYPWMTLTDWMGSP 381
            ::  .|:.:...|| .||.|                 .|.|.|.|.:...|         .:|:|
Human    73 SL--PSVYHPYIQP-QGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEP---------LLGAP 125

  Fly   382 FERVVCG--------------------------------------DFNGP-----NGCPRRRGRQ 403
            .|.:..|                                      |...|     :....|:.|.
Human   126 GELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRC 190

  Fly   404 TYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455
            .||::|||||||||.||.||||.||.|:|..|.|:|||:||||||||||:||
Human   191 PYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 37/51 (73%)
Abdominal-A 456..478 CDD:289192 72/247 (29%)
HOXB9NP_076922.1 Hox9_act 1..172 CDD:282473 30/175 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..47 7/25 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..182 2/32 (6%)
Homeobox 188..241 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.