DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HOXB1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_002135.2 Gene:HOXB1 / 3211 HGNCID:5111 Length:301 Species:Homo sapiens


Alignment Length:305 Identity:93/305 - (30%)
Similarity:116/305 - (38%) Gaps:76/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 AHQQLLLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAA 246
            ||......|||  ::||.||..|......|.||.....|...|.....|.......| :|.:..|
Human    24 AHSAPTSFPPS--SAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGVPFPS-SAPSGYA 85

  Fly   247 AAAASSSFAIPTSKMYPYVSN-------HPSSHGG-LSGMAGFTGLEDKSCSRYTDTVMNSYQSM 303
            .||.|.|:.  .|:.||...:       ||||:|. |.|::...|........|..         
Human    86 PAACSPSYG--PSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPP--------- 139

  Fly   304 SVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPR 368
            ..|...:.|.|.|   |.|.|..:|         :.....|  |:.                 |.
Human   140 QHPPYGNEQTASF---APAYADLLS---------EDKETPC--PSE-----------------PN 173

  Fly   369 YPWMTLTDWM---GSPFERVVCGD--FNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRR 428
            .|.....|||   .:|.:.....:  ...|:|.     |..:|..|..|||||||||.||:|.||
Human   174 TPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGL-----RTNFTTRQLTELEKEFHFNKYLSRARR 233

  Fly   429 IEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREE 473
            :|||..|.|.|.|:||||||||||.||             |:|||
Human   234 VEIAATLELNETQVKIWFQNRRMKQKK-------------REREE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 34/51 (67%)
Abdominal-A 456..478 CDD:289192 4/18 (22%)
HOXB1NP_002135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..77 16/54 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..149 3/30 (10%)
Antp-type hexapeptide 179..184 2/4 (50%)
Homeobox 207..259 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..301 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.