DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and HOXA9

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_689952.1 Gene:HOXA9 / 3205 HGNCID:5109 Length:272 Species:Homo sapiens


Alignment Length:275 Identity:84/275 - (30%)
Similarity:105/275 - (38%) Gaps:78/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 DNSPGSASASASASAAS--SVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSH----------- 272
            |.||.|..:.|:...||  .|.||.|.|..||          :|.:..:||..|           
Human    50 DFSPCSFQSKATVFGASWNPVHAAGANAVPAA----------VYHHHHHHPYVHPQAPVAAAAPD 104

  Fly   273 ------------GGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAAS 325
                        |.||    |.||...          ..|.....|.||...........|.   
Human   105 GRYMRSWLEPTPGALS----FAGLPSS----------RPYGIKPEPLSARRGDCPTLDTHTL--- 152

  Fly   326 AVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDF 390
            :::..:.|:..||..    .||:.|..........:|....|..|.....:|:.:...|      
Human   153 SLTDYACGSPPVDRE----KQPSEGAFSENNAENESGGDKPPIDPNNPAANWLHARSTR------ 207

  Fly   391 NGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455
              ...||       ||:.|||||||||.||.||||.||.|:|..|.|||||:||||||||||:||
Human   208 --KKRCP-------YTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKK 263

  Fly   456 ELRAVKEINEQARRD 470
                   ||:...:|
Human   264 -------INKDRAKD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 37/51 (73%)
Abdominal-A 456..478 CDD:289192 3/15 (20%)
HOXA9NP_689952.1 Hox9_act 1..193 CDD:309661 37/173 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..198 9/46 (20%)
Homeobox 209..262 CDD:306543 39/59 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.