DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and TLX2

DIOPT Version :10

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_057254.1 Gene:TLX2 / 3196 HGNCID:5057 Length:284 Species:Homo sapiens


Alignment Length:202 Identity:61/202 - (30%)
Similarity:86/202 - (42%) Gaps:51/202 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 AVSAASAGAIGVDSLGNACTQP-ASGVMPG----------------AGGA---------GGA-GI 363
            |.|....||.|....|:....| :|||.||                ||||         ||| |:
Human    49 AFSGGYHGASGYGPAGSLAPLPGSSGVGPGGVIRVPAHRPLPVPPPAGGAPAVPGPSGLGGAGGL 113

  Fly   364 ADLPRYPWM---------TLTDWMGSPFE--RVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEF 417
            |.| .:|||         .||..: |||.  |.:...:.......|::.|.:::|.|.||||:.|
Human   114 AGL-TFPWMDSGRRFAKDRLTAAL-SPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRF 176

  Fly   418 HFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQET 482
            ....||....|..:|.||.:|:.|:|.||||||.|.:::           ..:..|.|:.:|...
Human   177 LRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQ-----------TAEEREAERHRAGRL 230

  Fly   483 MKSAQQN 489
            :...||:
Human   231 LLHLQQD 237

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeodomain 399..455 CDD:459649 24/55 (44%)
Abdominal-A 456..478 CDD:403567 2/21 (10%)