DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and vnd

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster


Alignment Length:491 Identity:125/491 - (25%)
Similarity:194/491 - (39%) Gaps:115/491 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFDSMLPKYPQFQPFISSHHLT-TTPPNSSSAAVAAALAAAAASASASVSASSSSNNNSSNTIAG 68
            :||:.:|...:     |..|:: ......|....|||.|||||...:.:|..|:|.:.|.:...|
  Fly   187 LFDAKVPSSQR-----SGFHISDILNLEGSELKNAAAAAAAAAHHGSDLSHHSASESTSGHRGQG 246

  Fly    69 SNTSNTNNSSSSPSSSSNNNSNLNLSGGSLSPSHLSQHLGQSPHSPVSSSSPFQQHHPQVQQQHL 133
            |:||.:..|.:....|::.:.|.:.:||.         .|::.|     .|..:.|.|.      
  Fly   247 SHTSPSALSPTPAGVSADEHHNGSGTGGG---------AGEADH-----HSTTEHHAPP------ 291

  Fly   134 NHQQQQHLHHQQQQHHHQYSSLSAALQLQQQQHHISKLAAAAVASH------GHAHQQLLLTPPS 192
            :|.||||.||  |||||.:       .|..||||...:|...:|.|      .|||..     .:
  Fly   292 SHPQQQHPHH--QQHHHPH-------LLLPQQHHQQAVAPLPLAHHQSGEAQSHAHAN-----AA 342

  Fly   193 AGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASA--SAASSVAAAAAAAA-------- 247
            |.:..|..::.:.:..|:|  ....:|..|.|||.....|:  ..|.::...:..:|        
  Fly   343 AAHLLASHNAAAAAAVAAG--QYLPNLPKNFPGSFGDEMSSYHHMAQTMLQHSGRSAWIKENELY 405

  Fly   248 -----AAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTD-----------TV 296
                 |:..|:..:.:...|.|:.::..:...|||       :.||.||..|           |:
  Fly   406 GTQQPASPDSTSPVTSEVSYTYIGSNCQTSPALSG-------DYKSYSRSADSDALSVGDALHTL 463

  Fly   297 MNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGV-----DSLGNACTQPASGVMPGAG 356
            ..|..:.|...:.:|.......:.|...:..|..:.|..|.     |||.....:.....:..|.
  Fly   464 HGSSGNGSAGGAPTAHALHNNNNNTTNNNNHSLKAEGINGAGSGHDDSLNEDGIEEDIDDVDDAD 528

  Fly   357 GAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCP--RRRGRQTYTRFQTLELEKEFHF 419
            |:||                           ||.||.:|.|  :|:.|..:|:.||.|||:.|..
  Fly   529 GSGG---------------------------GDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQ 566

  Fly   420 NHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455
            ..||:...|..:|..:.||..|:||||||.|.|.|:
  Fly   567 QRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKR 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 125/491 (25%)
vndNP_476786.2 Homeobox 548..601 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.