DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Nkx2-3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001101064.1 Gene:Nkx2-3 / 309389 RGDID:1308521 Length:362 Species:Rattus norvegicus


Alignment Length:349 Identity:73/349 - (20%)
Similarity:105/349 - (30%) Gaps:155/349 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SPVSSSSPFQQHHPQVQQQHLNHQQQQHLHHQQQQHHHQYSSLSAALQLQQQQHHISKLAAAAVA 177
            ||| :|:||.      .:..||.:||:|.|             .|.||.:.:||           
  Rat     5 SPV-TSTPFS------VKDILNLEQQRHFH-------------GAHLQAELEQH----------- 38

  Fly   178 SHGHAHQQLLLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAA 242
                                                 ||                 ||...:|||
  Rat    39 -------------------------------------LH-----------------SAPCMLAAA 49

  Fly   243 AAAAAAAASSSFAIPTSKMYPYVSNHPSSHG-GLSGMAG----FTGLEDKSCSRYTDTVMNSYQS 302
            .....:.|.........:...|:::..::.| |:||:..    .|.|.| |||...:      |.
  Rat    50 EGTQFSDAGEEDEEEEGEKLSYLNSLAAAEGHGVSGLCPQSYVHTVLRD-SCSGPKE------QE 107

  Fly   303 MSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLP 367
            ..|.:..|.:..|..:...||..                  |.....|..|            .|
  Rat   108 EEVVSERSQKSCQLKKSLEAAGD------------------CKASEDGERP------------KP 142

  Fly   368 RYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIA 432
            |                            .||:.|..:::.|..|||:.|....||:...|..:|
  Rat   143 R----------------------------SRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLA 179

  Fly   433 HALCLTERQIKIWFQNRRMKLKKE 456
            .:|.||..|:||||||||.|.|::
  Rat   180 SSLKLTSTQVKIWFQNRRYKCKRQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
Nkx2-3NP_001101064.1 Homeobox 148..202 CDD:395001 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.