DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and dlx3b

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571397.2 Gene:dlx3b / 30585 ZFINID:ZDB-GENE-980526-280 Length:269 Species:Danio rerio


Alignment Length:344 Identity:79/344 - (22%)
Similarity:113/344 - (32%) Gaps:117/344 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 SPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPS 270
            |...|||.|.|.:..| ||             ::..::|......||......|..||...|  |
Zfish    14 STDLSGSMSCHPTSKD-SP-------------TLPESSATDMGYYSSHHEYYQSPPYPQQMN--S 62

  Fly   271 SHG-GLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQH-ATAAASAVSAASAG 333
            .|. .||||....|    :....|:...|:|:          |:..:.:. .|...|||.     
Zfish    63 YHQFNLSGMGATPG----AYPTKTEYPYNTYR----------QYGHYNRDLQTPPQSAVK----- 108

  Fly   334 AIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPR 398
                       .:|.:.|                                |:|       ||.|:
Zfish   109 -----------EEPETEV--------------------------------RMV-------NGKPK 123

  Fly   399 --RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVK 461
              |:.|..|:.:|...|::.|....||....|.|:|..|.||:.|:||||||||.|.||..:   
Zfish   124 KIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYK--- 185

  Fly   462 EINEQARRDREEQEKMKAQETM---------------KSAQQNK-QVQQQQQQQQQQQQQQQQQH 510
              |.:...:...    .|.::|               .|:|.|: |:.|..........:....|
Zfish   186 --NGEVPLEHSP----NASDSMACNSPPSPAVWDNNAHSSQVNRGQIPQPPLSSTPPYMEDYSNH 244

  Fly   511 QQQQQQPQDHHSIIAHNPG 529
            ..||.....|.   .|:||
Zfish   245 WYQQGSHLQHP---VHHPG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 1/21 (5%)
dlx3bNP_571397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 10/40 (25%)
DLL_N 28..104 CDD:289198 22/105 (21%)
Homeobox 128..181 CDD:278475 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..242 7/54 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..269 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.