DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and dlx4a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571375.1 Gene:dlx4a / 30561 ZFINID:ZDB-GENE-980526-73 Length:250 Species:Danio rerio


Alignment Length:278 Identity:61/278 - (21%)
Similarity:95/278 - (34%) Gaps:102/278 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 LTPPSAGNS-QAGDSSCSPSPSA-SGSSSLHRSLNDNSPGSASA-----SASASAASSVAAAAAA 245
            :|..|...| :|.|    ||.|| ...|..::|...:|||.:.|     .....|.|...||.:.
Zfish     1 MTMTSLSESLEASD----PSKSAFLEFSHGYQSHQQHSPGVSHAHYPVHGLHQGAHSQYDAAFSP 61

  Fly   246 AAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASAS 310
            .||    |::.|.:..|....:||.::                                :|    
Zfish    62 GAA----SYSRPLAYHYSTAHHHPGAY--------------------------------LP---- 86

  Fly   311 AQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLT 375
                  |||.:            |:|...:.:|.::..|.:..|.....|.|             
Zfish    87 ------YQHNS------------AVGYSRVEDADSEKQSSIESGEIRLNGKG------------- 120

  Fly   376 DWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTER 440
                   :::             |:.|..|:..|...|.:.|....||....|.::|..|.||:.
Zfish   121 -------KKI-------------RKPRTIYSSLQLQALNQRFQQTQYLALPERADLAAKLGLTQT 165

  Fly   441 QIKIWFQNRRMKLKKELR 458
            |:||||||:|.|.||.::
Zfish   166 QVKIWFQNKRSKYKKIMK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 21/51 (41%)
Abdominal-A 456..478 CDD:289192 0/3 (0%)
dlx4aNP_571375.1 COG5576 98..206 CDD:227863 29/119 (24%)
Homeobox 126..179 CDD:278475 21/52 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..202 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.