DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and lhx1b

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571282.1 Gene:lhx1b / 30454 ZFINID:ZDB-GENE-980526-116 Length:402 Species:Danio rerio


Alignment Length:161 Identity:44/161 - (27%)
Similarity:65/161 - (40%) Gaps:16/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 GSPFERVVCGDFNG-PNGCPRRRGRQTYTRFQTLE-LEKEFHFNHYLTRRRRIEIAHALCLTERQ 441
            |...::..|.:.|. .|...:|||.:|..:.:.|| |:..|......||..|.::|....|..|.
Zfish   157 GPMSDKETCNNENDEQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRV 221

  Fly   442 IKIWFQNRRMKLK--KELRAV----KEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQ 500
            |::||||||.|.:  |:|.|:    .......||.|...::|:..|.|.:...:        ...
Zfish   222 IQVWFQNRRSKERRMKQLSALGARRHMFFRSPRRMRALGDRMEPGELMANGHFS--------FYG 278

  Fly   501 QQQQQQQQQHQQQQQQPQDHHSIIAHNPGHL 531
            ..|.:...........||...|..||.||.|
Zfish   279 DYQSEYYGPGSNYDYFPQGPPSSQAHTPGDL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 19/52 (37%)
Abdominal-A 456..478 CDD:289192 5/25 (20%)
lhx1bNP_571282.1 LIM1_Lhx1_Lhx5 4..55 CDD:188753
LIM2_Lhx1_Lhx5 63..118 CDD:188761
Homeobox 181..234 CDD:278475 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.