DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxc3a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001128157.2 Gene:hoxc3a / 30421 ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio


Alignment Length:150 Identity:56/150 - (37%)
Similarity:69/150 - (46%) Gaps:22/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 GNACTQPASGVMPGAGGAGGAGIADLPRYPWM--TLTDWMGSPFERVVCGDFNGPNG------CP 397
            ||....||:.:................:||||  |......|....:..||....||      ..
Zfish    93 GNHSLDPANALEREKACELSTSCLSTMKYPWMRETHAPTHFSSINAMESGDSKYSNGEAVVRNSS 157

  Fly   398 RRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKE 462
            .:|.|..:|..|.|||||||||:.||.|.||:|:|..|.||:|||||||||||||.||       
Zfish   158 SKRARVAFTSSQLLELEKEFHFSAYLCRNRRLEMAELLKLTDRQIKIWFQNRRMKYKK------- 215

  Fly   463 INEQARRDREEQEKMKAQET 482
                   |.:|:...|:..|
Zfish   216 -------DHKEKSTAKSSYT 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 35/51 (69%)
Abdominal-A 456..478 CDD:289192 2/21 (10%)
hoxc3aNP_001128157.2 Abdominal-A 123..246 CDD:332641 49/119 (41%)
Homeobox 162..214 CDD:306543 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.