Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571242.1 | Gene: | hoxd11a / 30405 | ZFINID: | ZDB-GENE-990415-117 | Length: | 276 | Species: | Danio rerio |
Alignment Length: | 257 | Identity: | 62/257 - (24%) |
---|---|---|---|
Similarity: | 94/257 - (36%) | Gaps: | 77/257 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 252 SSFAIPTSKM---YPYVSN------------------HPSSHGGLSGMAGFTGLED--------- 286
Fly 287 ---------------------KSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAA 330
Fly 331 SAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGD--FNGP 393
Fly 394 NGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 27/51 (53%) |
Abdominal-A | 456..478 | CDD:289192 | 62/257 (24%) | ||
hoxd11a | NP_571242.1 | DUF3528 | 23..158 | CDD:288866 | 24/149 (16%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 139..207 | 11/83 (13%) | |||
Homeobox | 207..260 | CDD:278475 | 27/52 (52%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |