DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxd11a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571242.1 Gene:hoxd11a / 30405 ZFINID:ZDB-GENE-990415-117 Length:276 Species:Danio rerio


Alignment Length:257 Identity:62/257 - (24%)
Similarity:94/257 - (36%) Gaps:77/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 SSFAIPTSKM---YPYVSN------------------HPSSHGGLSGMAGFTGLED--------- 286
            |||...|:..   :||.||                  |||........|.:...|:         
Zfish    29 SSFLPQTTSCQVNFPYSSNIAQVQPVREVTFRDYGLDHPSKWHYRGNYASYYSTEEIMHRDLLQS 93

  Fly   287 ---------------------KSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAA 330
                                 .|||.:|:...|..    :|..    |.||::.|.:.......:
Zfish    94 TNRAEMIFKNDSMYSHHAGTNSSCSFFTNVGRNGV----LPQG----FDQFFETANSEKPNPEQS 150

  Fly   331 SAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGD--FNGP 393
            .             .:|.:.| ||......:  .|.........||.:........|.:  .:|.
Zfish   151 K-------------QKPDTSV-PGDAACNPS--TDSAEQTKQDPTDTVEEESSVSTCDEEKNSGS 199

  Fly   394 NGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455
            :....|:.|..|:::|..|||:||.||.|:.:.:|::::..|.||:||:||||||||||.||
Zfish   200 SATKSRKKRCPYSKYQIRELEREFFFNVYINKEKRLQLSRMLSLTDRQVKIWFQNRRMKEKK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 27/51 (53%)
Abdominal-A 456..478 CDD:289192 62/257 (24%)
hoxd11aNP_571242.1 DUF3528 23..158 CDD:288866 24/149 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..207 11/83 (13%)
Homeobox 207..260 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.