DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxc5a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571219.2 Gene:hoxc5a / 30379 ZFINID:ZDB-GENE-980526-533 Length:233 Species:Danio rerio


Alignment Length:264 Identity:88/264 - (33%)
Similarity:113/264 - (42%) Gaps:91/264 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 GDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYP 263
            |.|..|..|    ::||.|.. .|:...|.:||:.....|       .:|..|.||         
Zfish    46 GGSFSSQIP----TNSLRREA-INTTDRARSSAAVQRTQS-------CSALGSRSF--------- 89

  Fly   264 YVSNH---PSSHGGLSGMA-GFTGLEDKSC--SRYTDTVMNSYQSMSVPASASAQFAQFYQHATA 322
             ||.|   |.|||.||..| |...:.:|..  ||..|..|.:..::....:::.:..|       
Zfish    90 -VSTHGYNPLSHGLLSQKAEGNMEVMEKPSGKSRTDDIKMETTSAIKQQTNSTQRQNQ------- 146

  Fly   323 AASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVC 387
                                  :||..                   |||||         :..:.
Zfish   147 ----------------------SQPQI-------------------YPWMT---------KLHMS 161

  Fly   388 GDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 452
            .:.:|      :|.|.:|||:||||||||||||.|||||||||||:.|||.||||||||||||||
Zfish   162 HESDG------KRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMK 220

  Fly   453 LKKE 456
            .||:
Zfish   221 WKKD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 44/51 (86%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
hoxc5aNP_571219.2 Homeobox 169..222 CDD:278475 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.