DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxb1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_220896.4 Gene:Hoxb1 / 303491 RGDID:1310298 Length:297 Species:Rattus norvegicus


Alignment Length:297 Identity:91/297 - (30%)
Similarity:115/297 - (38%) Gaps:94/297 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNS-------PGSASASASASAASSVAAAAAAAA 247
            |||  ::.|.||....|....|..|  .:|..||       |.|...|..:||.|..|.||...:
  Rat    29 PPS--SAPAVDSYAGESRYGGGLPS--SALQQNSGYPVQQPPSSLGVSFPSSAPSGYAPAACNPS 89

  Fly   248 AAASSSFAIPTSK---MYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSV---- 305
            ...|..:::..|:   .|    .||||:|...|     ||.|            ||.:..|    
  Rat    90 YGPSQYYSMGQSEGDGGY----FHPSSYGAQLG-----GLPD------------SYGAGGVGSGP 133

  Fly   306 -----PASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIAD 365
                 |...:.|.:.|       |||....|.     |...:..::|:|                
  Rat   134 YPPPQPPYGTEQTSNF-------ASAYDLLSE-----DKESSCSSEPSS---------------- 170

  Fly   366 LPRYPWMTLT----DWM---GSPFERVVCGD--FNGPNGCPRRRGRQTYTRFQTLELEKEFHFNH 421
                    ||    |||   .:|.:.....:  ...|.|.     |..:|..|..|||||||||.
  Rat   171 --------LTARTFDWMKVKRNPPKTAKVSELGLGTPGGL-----RTNFTTRQLTELEKEFHFNK 222

  Fly   422 YLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELR 458
            ||:|.||:|||..|.|.|.|:||||||||||.||..|
  Rat   223 YLSRARRVEIAATLELNETQVKIWFQNRRMKQKKRER 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 34/51 (67%)
Abdominal-A 456..478 CDD:289192 1/3 (33%)
Hoxb1XP_220896.4 Homeobox 203..255 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.