DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxd3a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571200.1 Gene:hoxd3a / 30349 ZFINID:ZDB-GENE-990415-120 Length:396 Species:Danio rerio


Alignment Length:235 Identity:77/235 - (32%)
Similarity:102/235 - (43%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 AAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVM--------------- 297
            |.....::.|.|..|.|    ..:|.|.|..:.....:...|...|.:|.               
Zfish    10 AGLFGGYSYPKSDSYTY----GPTHQGFSSSSIENDYQSPICPIQTTSVRQATHKNGDINGSCMR 70

  Fly   298 -NSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGA 361
             ::.|..|.|.|.|.|    .|.|..|||:.|.::          |:..:..|   |.:.|:..|
Zfish    71 PSASQGNSQPESISEQ----QQAAPLAASSPSPST----------NSTQKKKS---PSSNGSSTA 118

  Fly   362 -GIADLPRYPWMTLT------DWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHF 419
             .:.....:|||..|      .....|.....|.| ..|.|...:|.|..||..|.:||||||||
Zfish   119 TPVISKQIFPWMKETRQNAKQKSTNCPAAGETCDD-KSPPGPASKRVRTAYTSAQLVELEKEFHF 182

  Fly   420 NHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRA 459
            |.||.|.||:|:|:.|.||||||||||||||||.||:.::
Zfish   183 NRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 37/51 (73%)
Abdominal-A 456..478 CDD:289192 0/4 (0%)
hoxd3aNP_571200.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..163 36/166 (22%)
Abdominal-A 116..237 CDD:332641 50/108 (46%)
Antp-type hexapeptide 126..131 2/4 (50%)
Homeobox 165..217 CDD:306543 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..246 0/4 (0%)
DUF4074 333..394 CDD:315871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.