DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxb3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001100512.1 Gene:Hoxb3 / 303488 RGDID:1310780 Length:429 Species:Rattus norvegicus


Alignment Length:325 Identity:88/325 - (27%)
Similarity:114/325 - (35%) Gaps:115/325 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 QQQQHLHHQQQQHHHQYSSLSAALQLQQQQHHISKLAAAAVASHGHAHQQLLLTPPSAGNSQAGD 200
            |...||....|:......||..|     ..|..||....:....|.|.:. |..||.        
  Rat    38 QAATHLEGDYQRSACSLQSLGNA-----APHAKSKELNGSCMRPGLAPEP-LPAPPG-------- 88

  Fly   201 SSCSPSPSASGSSSLHRSLNDNSPG-SASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPY 264
               ||.|||:.:|:...|.|...|. |......||:.|::                  |.:::|:
  Rat    89 ---SPPPSAAPTSTTSNSNNGGGPSKSGPPKCGASSNSTL------------------TKQIFPW 132

  Fly   265 VSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSA 329
            :..                      ||.|..:.||                    :...|.....
  Rat   133 MKE----------------------SRQTSKLKNS--------------------SPGTAEGCGG 155

  Fly   330 ASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPN 394
            ...|..|            .|...|.||:||.|                         ||.:.|.
  Rat   156 GGGGGGG------------GGSSSGGGGSGGGG-------------------------GDKSPPG 183

  Fly   395 GCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRA 459
            ....:|.|..||..|.:|||||||||.||.|.||:|:|:.|.|:||||||||||||||.||:.:|
  Rat   184 SAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKA 248

  Fly   460  459
              Rat   249  248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 36/51 (71%)
Abdominal-A 456..478 CDD:289192 1/4 (25%)
Hoxb3NP_001100512.1 Homeobox 191..244 CDD:395001 36/52 (69%)
DUF4074 365..427 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.