Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571196.2 | Gene: | hoxb9a / 30344 | ZFINID: | ZDB-GENE-990415-109 | Length: | 249 | Species: | Danio rerio |
Alignment Length: | 247 | Identity: | 74/247 - (29%) |
---|---|---|---|
Similarity: | 97/247 - (39%) | Gaps: | 84/247 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 271 SHGGLSGMAGFTGLEDKSCSRYTDTVMNS-----------YQSMSV---PASASAQFAQFYQHAT 321
Fly 322 AAASAVSAASAGAIGVDSLGNA-------CTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMG 379
Fly 380 SP--------------------------FE--RVVC---GDFNGP----------NGCPRRRGRQ 403
Fly 404 TYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 38/51 (75%) |
Abdominal-A | 456..478 | CDD:289192 | 74/247 (30%) | ||
hoxb9a | NP_571196.2 | Hox9_act | 1..171 | CDD:282473 | 33/175 (19%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 146..182 | 6/35 (17%) | |||
Homeobox | 187..240 | CDD:278475 | 38/52 (73%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |