DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxb9a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571196.2 Gene:hoxb9a / 30344 ZFINID:ZDB-GENE-990415-109 Length:249 Species:Danio rerio


Alignment Length:247 Identity:74/247 - (29%)
Similarity:97/247 - (39%) Gaps:84/247 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 SHGGLSGMAGFTGLEDKSCSRYTDTVMNS-----------YQSMSV---PASASAQFAQFYQHAT 321
            ||.|          ||.:.||:::...:|           :.|.|.   |...|:.::.|..||:
Zfish    17 SHEG----------EDPNASRFSNVQYSSARQPGPGEHPEFPSCSFQPKPPVFSSSWSPFSSHAS 71

  Fly   322 AAASAVSAASAGAIGVDSLGNA-------CTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMG 379
            ....||.........|.|....       |. |.:..:||.|           :.....|...:|
Zfish    72 NGLPAVYHPYIPTQPVPSTDTRYLRTWLDCA-PRAEPLPGQG-----------QVKMEPLLGHLG 124

  Fly   380 SP--------------------------FE--RVVC---GDFNGP----------NGCPRRRGRQ 403
            .|                          ||  :.:|   .|..||          :....|:.|.
Zfish   125 EPPKLVGQHEYILESSTAREINSGHSAGFEDNKDICEGSEDKEGPDQNDPSANWLHARSSRKKRC 189

  Fly   404 TYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455
            .||::|||||||||.||.||||.||.|:|..|.|||||:||||||||||:||
Zfish   190 PYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLTERQVKIWFQNRRMKMKK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 38/51 (75%)
Abdominal-A 456..478 CDD:289192 74/247 (30%)
hoxb9aNP_571196.2 Hox9_act 1..171 CDD:282473 33/175 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..182 6/35 (17%)
Homeobox 187..240 CDD:278475 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.