Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571194.1 | Gene: | hoxb6a / 30341 | ZFINID: | ZDB-GENE-990415-106 | Length: | 228 | Species: | Danio rerio |
Alignment Length: | 242 | Identity: | 98/242 - (40%) |
---|---|---|---|
Similarity: | 110/242 - (45%) | Gaps: | 75/242 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 277 GMAGFTGLEDKSCSRYTDTVM---------NSYQSMSVPASASAQFAQFYQHATAAASAVSAAS- 331
Fly 332 ------------------------AGAIGVDSLGNACTQPASGVMPGAGGAGGAGI---AD---- 365
Fly 366 -LPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRI 429
Fly 430 EIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEK 476 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 49/51 (96%) |
Abdominal-A | 456..478 | CDD:289192 | 8/21 (38%) | ||
hoxb6a | NP_571194.1 | Antp-type hexapeptide | 132..137 | 4/14 (29%) | |
Homeobox | 154..206 | CDD:278475 | 49/51 (96%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45659 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.870 |