DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxb6a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571194.1 Gene:hoxb6a / 30341 ZFINID:ZDB-GENE-990415-106 Length:228 Species:Danio rerio


Alignment Length:242 Identity:98/242 - (40%)
Similarity:110/242 - (45%) Gaps:75/242 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 GMAGFTGLEDKSCSRYTDTVM---------NSYQSMSVPASASAQFAQFYQHATAAASAVSAAS- 331
            |...|.|......|.|||.:.         :|.|..:.|:|       |||.|..|.|..:||. 
Zfish    17 GQESFLGQIPLYSSGYTDPLRHYPGAAYGGSSVQEKAYPSS-------FYQQANGAYSRATAAGP 74

  Fly   332 ------------------------AGAIGVDSLGNACTQPASGVMPGAGGAGGAGI---AD---- 365
                                    :..:..|.....||           |:.|..|   ||    
Zfish    75 CDYATASFYREKDPACALASIEEHSFVLSQDHRKTDCT-----------GSTGKSIYPEADEQKP 128

  Fly   366 -LPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRI 429
             .|.||||          :|:  ...||..|...|||||||||:||||||||||||.||||||||
Zfish   129 SAPVYPWM----------QRM--NSCNGTFGNAGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRI 181

  Fly   430 EIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEK 476
            |||||||||||||||||||||||.|||   .|.||.......||:||
Zfish   182 EIAHALCLTERQIKIWFQNRRMKWKKE---NKLINCSQTSGEEEEEK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 49/51 (96%)
Abdominal-A 456..478 CDD:289192 8/21 (38%)
hoxb6aNP_571194.1 Antp-type hexapeptide 132..137 4/14 (29%)
Homeobox 154..206 CDD:278475 49/51 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.